Protein Info for ABIE53_006406 in Paraburkholderia graminis OAS925

Annotation: peptide/nickel transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 transmembrane" amino acids 56 to 80 (25 residues), see Phobius details amino acids 127 to 152 (26 residues), see Phobius details amino acids 163 to 181 (19 residues), see Phobius details amino acids 187 to 204 (18 residues), see Phobius details amino acids 239 to 265 (27 residues), see Phobius details amino acids 287 to 310 (24 residues), see Phobius details PF12911: OppC_N" amino acids 50 to 87 (38 residues), 24.4 bits, see alignment 2.1e-09 PF00528: BPD_transp_1" amino acids 140 to 322 (183 residues), 94.3 bits, see alignment E=8e-31

Best Hits

Swiss-Prot: 36% identical to DPPC_HAEIN: Dipeptide transport system permease protein DppC (dppC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 86% identity to bxe:Bxe_C0142)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (325 amino acids)

>ABIE53_006406 peptide/nickel transport system permease protein (Paraburkholderia graminis OAS925)
MASESSNIISTTPKQSAGSSSWRRQLAGALFGQRRERIAAAGLSRRSGRGVLRTLAGNPS
ALSGLVLLAAFIVLALAAPHLFPGDPLDMVAAPFEWPGSDPQYWLGTDSLGRDVAAGIAH
GTRVSLLIGASAAGIGLLIGTLVGAVGGFFGGLVDNVLVRVTELFQTIPSFLLVIVIVAI
GRPSVEVIALAIGVASWPTVARIVRAEFRTLREADFVLAARTQGFGNARIIFGEILPNAL
PPVIVTASVMVASAILIESSLSFLGMGDPNVVSWGAMIGAGRDSLRTAWYLTAVPGTAIV
VAVLALNLLGDGLNDALNPRLRERT