Protein Info for ABIE53_006383 in Paraburkholderia graminis OAS925

Annotation: tetratricopeptide (TPR) repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 539 PF13432: TPR_16" amino acids 26 to 83 (58 residues), 34.1 bits, see alignment 1.9e-11 amino acids 133 to 189 (57 residues), 20.5 bits, see alignment 3.5e-07 amino acids 162 to 226 (65 residues), 38.3 bits, see alignment E=9.5e-13 PF14559: TPR_19" amino acids 33 to 86 (54 residues), 29.9 bits, see alignment 3.8e-10 PF13181: TPR_8" amino acids 158 to 189 (32 residues), 18.6 bits, see alignment (E = 1e-06) amino acids 192 to 225 (34 residues), 26.5 bits, see alignment (E = 3e-09) PF07719: TPR_2" amino acids 193 to 225 (33 residues), 30.4 bits, see alignment (E = 1.6e-10) PF13374: TPR_10" amino acids 193 to 221 (29 residues), 20.5 bits, see alignment (E = 2.5e-07) PF00515: TPR_1" amino acids 193 to 225 (33 residues), 33.1 bits, see alignment (E = 2.2e-11) PF01075: Glyco_transf_9" amino acids 432 to 486 (55 residues), 34.2 bits, see alignment 1.2e-11

Best Hits

KEGG orthology group: None (inferred from 63% identity to bph:Bphy_4648)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (539 amino acids)

>ABIE53_006383 tetratricopeptide (TPR) repeat protein (Paraburkholderia graminis OAS925)
MGLYDLWTDRTCLVPSVMSHDTEHILAAAQANLQAGRLDDAASLLHGILKTAPDHGEALT
GLGYIAAQQGDHARAADYLIQASERASLSWHQLKFAAQVCRLAQRRDAAIALLERCLAQC
RNDAAALHGVAVSLIELGQSQRALEVFVHLCKVHPQLAEAHYNRGTLLGTMGRYDDELDA
YRQAIALKPRFVRAYVNLGVALRDLRRFDEALLQFRKALSIDPNDAGARTNRAQTNLLLG
EFEHGWREYEWRWRDGTGDHGFPQHSLWTGAQPIGGKTVLVHHEQGFGDTLQFVRFVDQL
SAAGAHVVLRVQDALLPLLRHYPGAAEVIGETDQVKHFDYHIPTMSLPFALKVGTPGPAL
SGPYLQADEELVRQWDELLPVSRRRPRIGIVWSGSCTHLNDHNRSIPLEQLKPVFETDAE
FFALQPDVRDSDRACLAQLEQSGALRDVSGRLTSFAETAALIARLDLVVSVDTAVAHLAG
ALGKPVWIALPFMPDWRWQLDRSDSPWYANARLFRQTTRGDWTDVVDALRAEIDALPDV