Protein Info for ABIE53_006378 in Paraburkholderia graminis OAS925

Annotation: biopolymer transport protein ExbB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 111 to 134 (24 residues), see Phobius details amino acids 154 to 179 (26 residues), see Phobius details PF01618: MotA_ExbB" amino acids 72 to 191 (120 residues), 107.4 bits, see alignment E=2.3e-35

Best Hits

KEGG orthology group: K03561, biopolymer transport protein ExbB (inferred from 100% identity to bgf:BC1003_5811)

Predicted SEED Role

"biopolymer transport protein, MotA/TolQ/ExbB proton channel family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (203 amino acids)

>ABIE53_006378 biopolymer transport protein ExbB (Paraburkholderia graminis OAS925)
MLNTLINYSVQSMGLIPLLAFIFLLGISIIVERFMFFSRAVKAGKTLEHDLKMVEPANLS
DAQKVAEHYGQTVQGELVKSALKVRGKPEAVVERELEETIMFQMPRLDRNLWILDTAVTL
GPLLGLLGTIIGMVESFNVLGTSGTANPNGVTGGIGHALTATACGLTIAIVCVIFLNYFN
KRIRMTVNQFDLIKSLLVSRFAA