Protein Info for ABIE53_006329 in Paraburkholderia graminis OAS925

Annotation: 4-hydroxy-2-oxoheptanedioate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03328: HpcH_HpaI
  • amino acids 27 to 264 (238 residues), 83 bits, E=9.6e-28

Best Hits

KEGG orthology group: K02510, 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase [EC: 4.1.2.-] (inferred from 84% identity to hba:Hbal_2609)

Predicted SEED Role

"2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase (EC 4.1.2.n4)" (EC 4.1.2.n4)

KEGG Metabolic Maps

• Fructose and mannose metabolism
• Lysine degradation
• Naphthalene and anthracene degradation
• Pentose phosphate pathway
• Phenylalanine, tyrosine and tryptophan biosynthesis
• Tyrosine metabolism
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.1.2.-, 4.1.2.n4

Use Curated BLAST to search for 4.1.2.- or 4.1.2.n4

Protein Sequence (285 amino acids)

>ABIE53_006329 4-hydroxy-2-oxoheptanedioate aldolase (Paraburkholderia graminis OAS925)
MSDTRLNSIIRAFESGKPAFAAFSKLDKQTAIEMSDAPYDGIVFEMEHNPYDVTALGDAL
QYMLSRKQIAESGSVAPRVTPIARIPANGAEMNQAFAKQVLDRGAYGVIWPHVATVEQAY
NAVASCRYARPKSAPLYEPKGVRGDGPANAARYWGLSMADYYRKADVWPLAPQGEILVGL
MCESTEAIENLDDILSNVPGIGFILIGEGDLSQELGYPRDYEHPVVVDAMRKIVETCRKH
NVVVGNPHVNAKNHKRLLEEGYRFLMSAPLRSYGVVGMAREMAGY