Protein Info for ABIE53_006295 in Paraburkholderia graminis OAS925

Annotation: ribose transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 42 to 59 (18 residues), see Phobius details amino acids 66 to 86 (21 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details amino acids 124 to 144 (21 residues), see Phobius details amino acids 164 to 184 (21 residues), see Phobius details amino acids 215 to 235 (21 residues), see Phobius details amino acids 242 to 262 (21 residues), see Phobius details amino acids 269 to 288 (20 residues), see Phobius details amino acids 296 to 315 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 42 to 308 (267 residues), 92.5 bits, see alignment E=1.3e-30

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 34% identity to bra:BRADO4791)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (322 amino acids)

>ABIE53_006295 ribose transport system permease protein (Paraburkholderia graminis OAS925)
MSATLTSRRMLLLVLVVLVMVGGQWAVPGFTNADQLGNQLKIATFLGLFGISQTLAMMAG
GQGLDLSVGAVATLGGIIGAAVINVGPAGLPVGLPLAFFAAALCGAVVGVINGCGITVFK
VPPLVMTLAMASLVDGGFIVWSSLMHVNTAASATLVALAGRSVAGVPTVAVLWLVAGTAV
WWFLDRSAWGRRLMATGANPTAALLTGTRVRAVRIAAYTASAMIAALTGVLLVGYVGQAF
LGLGSGYVLTSVVVAVIGGVSLGGGRGDYIAVAIAALFITALTSLLTALQIGEAGRQCIF
GATLIVFLTMNGWSVGRRAMAA