Protein Info for ABIE53_006211 in Paraburkholderia graminis OAS925

Annotation: DeoR family glycerol-3-phosphate regulon repressor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 PF08220: HTH_DeoR" amino acids 6 to 60 (55 residues), 58.2 bits, see alignment E=8.5e-20 PF08279: HTH_11" amino acids 6 to 48 (43 residues), 28.7 bits, see alignment 1.5e-10 PF00455: DeoRC" amino acids 76 to 232 (157 residues), 143.4 bits, see alignment E=9.3e-46

Best Hits

Swiss-Prot: 31% identical to ACCR_AGRFC: Transcriptional repressor AccR (accR) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02444, DeoR family transcriptional regulator, glycerol-3-phosphate regulon repressor (inferred from 92% identity to bug:BC1001_5776)

Predicted SEED Role

"Transcriptional regulator, DeoR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (259 amino acids)

>ABIE53_006211 DeoR family glycerol-3-phosphate regulon repressor (Paraburkholderia graminis OAS925)
MLSTQRQAEILRLVREQRTCTITALAARFEVSDETIRRNIKPLIAQGLLLKVHGGITLPE
RLDEPPFERRMAASLAGKRAIGARIAELVSDGDSLILDGGSTCVHIARALVARSRLTVVT
NSIEVARLLAPHNGNRVFIAGGEVRADDAAAVGDSVQAFLRQFHVRYAIVSVTAIDMRGH
FMDALPADVAFSLAAFAQAERRVVAADHAKFGHSALLHAFGADCVDVLVTDEAPAPALGQ
LLAAAGVEVVVGVPAGGEA