Protein Info for ABIE53_006134 in Paraburkholderia graminis OAS925

Annotation: Fe-S oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 637 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 71 to 93 (23 residues), see Phobius details amino acids 99 to 116 (18 residues), see Phobius details amino acids 137 to 156 (20 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details PF11982: DUF3483" amino acids 6 to 217 (212 residues), 277.5 bits, see alignment E=3.4e-86 PF13183: Fer4_8" amino acids 247 to 336 (90 residues), 38.8 bits, see alignment E=4.4e-13 PF13237: Fer4_10" amino acids 247 to 335 (89 residues), 37.1 bits, see alignment E=1e-12 PF13187: Fer4_9" amino acids 249 to 336 (88 residues), 31 bits, see alignment E=8.3e-11 PF02754: CCG" amino acids 529 to 615 (87 residues), 48.8 bits, see alignment E=2.6e-16

Best Hits

KEGG orthology group: None (inferred from 98% identity to bug:BC1001_5841)

Predicted SEED Role

"Iron-sulfur cluster-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (637 amino acids)

>ABIE53_006134 Fe-S oxidoreductase (Paraburkholderia graminis OAS925)
MSPVSVITVLLWLSMAGLAFALAKRAAYWREGRATAAGAYGWANLLSIPKRYFVDLHHVV
ARDPYIAKTHVATAGGAILAMALVFVNYGLAIYSPWLDKLIFLAALVMLVGAVFVWRRRH
GAKAVPARLSRGPWDHLPLLLGSFALGLVLFVALPASAMSGALAIIVALLIAVGAFTMTF
GAARGGPMKHALAGLLHLAFHPRQERFAERNSKDVVPPTALKVPLLDAKEYGVGKPVEFR
WNQLLSFDACVQCGKCEAACPAFAAGQPLNPKKLIQDLVTGMVGGTDAEYAGSPTPGIPV
GKHGGAPQKPLISSLIEAETLWSCTTCRACVQECPMLIEHVDAIVDMRRNQTLVEGTVPG
KGPITLANLRETGSANGYDIGARYDWAVDLQVQVAQPGRRVDVLLIAGEGAFDMRYQRTL
RALVKVLNRAGIDYAVLGGVETDTGDTARRLGDEATFQQLASKLIGTLSQYSFGKIVTAD
PHVLHSLRNEYRALGGFYEVQHHTALIDELIASGKLSPRAAAAYADSKITYHDPCYLGRY
NGETEAPRRVLKSIGIKVVEMERNGMRGRCCGGGGGAPLTDIPGKRRIPDIRIDDARGIG
ANIVAVGCPNCTAMLEGVVGPRPEVLDVAELVAAALE