Protein Info for ABIE53_006133 in Paraburkholderia graminis OAS925

Annotation: electron transfer flavoprotein alpha subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 PF01012: ETF" amino acids 60 to 224 (165 residues), 57.3 bits, see alignment E=1.9e-19 PF00766: ETF_alpha" amino acids 249 to 325 (77 residues), 94 bits, see alignment E=4.3e-31

Best Hits

KEGG orthology group: K03522, electron transfer flavoprotein alpha subunit (inferred from 94% identity to bug:BC1001_5842)

Predicted SEED Role

"Electron transfer flavoprotein, alpha subunit" in subsystem Acetyl-CoA fermentation to Butyrate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (389 amino acids)

>ABIE53_006133 electron transfer flavoprotein alpha subunit (Paraburkholderia graminis OAS925)
MNTIKRIDPRRPFTITADGLRRITLGAIGVAGALDFTAASGAHREQPKPRRTTAAPSHTM
LVAAHADRGALDEHARQTLAAAALVADASTEVVLLVFGEFTGDAAALGADKLIELPMFDR
RKFAPVDELNALAACVAAYAPVHVFLPDNATGDGDLGRRYAAAANASVATHVVEIDASHV
AAYVHANTALASRALPEVVLLAANAVDPKLPFVGAGERVVWRFDGESASAKGTVRDLGIE
EMDAAQLALEEADFIVSAGNGVSDVPAFERLAATLGAAIGASRVAVDDGKFTRDKQIGAT
GKTVEASVYIAFGISGAVQHLQGIKDCRHVIAVNLDASAPIAKRANLTVIADAQETIAAL
NDAAAAARSARGTGAALLNSKAVAEGALA