Protein Info for ABIE53_006024 in Paraburkholderia graminis OAS925

Annotation: sulfonate transport system substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details TIGR01728: ABC transporter, substrate-binding protein, aliphatic sulfonates family" amino acids 50 to 324 (275 residues), 229.6 bits, see alignment E=2.4e-72 PF04069: OpuAC" amino acids 76 to 250 (175 residues), 23.9 bits, see alignment E=4.4e-09 PF13379: NMT1_2" amino acids 78 to 274 (197 residues), 34 bits, see alignment E=4.2e-12 PF09084: NMT1" amino acids 92 to 254 (163 residues), 52.9 bits, see alignment E=7.1e-18

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 92% identity to bug:BC1001_6069)

Predicted SEED Role

"Alkanesulfonates-binding protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization or Putative sulfate assimilation cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (333 amino acids)

>ABIE53_006024 sulfonate transport system substrate-binding protein (Paraburkholderia graminis OAS925)
MSTTTNRNHRRSFIKLSVGAAAAAASVAVSPLVSPLAFAQGPSQGAPRSLRIGNQKGYLN
LLKGRGTLEKRLAPLNVSVSWTEFAAGPVQLEALNVGSIDFGDVGEAPPIFAQAAGAPLA
YVAATVPRPQSEAVLVPPGSSIRSVADLKGKKIALNRGSNVHYFLVKLLRQHGLQYSDVN
VAYLAPADARAAFERASIDAWVIWDPFFAAAQKTLGARVVADASGVVGNRGYYFSSQSYV
AKNPDVIRIVIEEIEKVDQWGSRNKDQLSSELAQLWGLPKPVVDAAVARQQFGTERITRA
ILGEQQQIADAFLDLGLIPKHVDVLRAGPPNLA