Protein Info for ABIE53_005886 in Paraburkholderia graminis OAS925

Annotation: L-lactate dehydrogenase complex protein LldF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02589: LUD_dom
  • amino acids 66 to 278 (213 residues), 113.7 bits, E=1.8e-36
• PF13183: Fer4_8
  • amino acids 303 to 368 (66 residues), 42.7 bits, E=1.4e-14
• PF00037: Fer4
  • amino acids 304 to 317 (14 residues), 21.8 bits, see alignment (E = 2.5e-08)

Best Hits

Swiss-Prot: 40% identical to LUTB_EXISA: Lactate utilization protein B (lutB) from Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)

KEGG orthology group: None (inferred from 96% identity to bug:BC1001_3731)

MetaCyc: 47% identical to L-lactate dehydrogenase iron-sulfur cluster-binding protein LldF (Shewanella oneidensis)
L-lactate dehydrogenase (cytochrome). [EC: 1.1.2.3]

Predicted SEED Role

"Predicted L-lactate dehydrogenase, Iron-sulfur cluster-binding subunit YkgF" in subsystem L-rhamnose utilization or Lactate utilization

MetaCyc Pathways

• methylglyoxal degradation V (2/3 steps found)
• lactate fermentation to acetate, CO₂ and hydrogen (Desulfovibrionales) (4/8 steps found)

KEGG Metabolic Maps

• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.2.3

Use Curated BLAST to search for 1.1.2.3

Protein Sequence (463 amino acids)

>ABIE53_005886 L-lactate dehydrogenase complex protein LldF (Paraburkholderia graminis OAS925)
MSRIDHAKAAGEFIRKTEHVAFHDKRLWDLREKRDAQAHGIAEWETLRELASGIKEHTLS
NLSEYLEQFAAAAEANGVVVHWASTAEEHNALVYQIMSARGMTTLVKSKSMLTDECKMRE
YLEPRGITVMETDLGERIQQLDHQDPSHMVVPAVHKLRADVAQLFGRTIGTDPNNSDIHY
LAESQRMNTRPYFVREKTAGMTGCNFAVAETGTVVVCTNEGNADLSANVPPLHIASIGIE
KLIPKVADLGVFIRMLSRSALGSPITQYTSHFRAPRPGTEMHYILVDHGRSERLAMEDFW
YSLKCIRCGACMNTCPVYRRSGGLSYGGTYSGPIGAIINPTFDLKRYSALPFASTLNGSC
TNVCPVKINIHEQIYKWRTVIAERHEVPFVKQEVLKMAGRLLASPTLYRATVASMSGALR
RLPNFVLYNPLNIWGRQRELPEAPKQTFHAWYRKNRGGDDGNA