Protein Info for ABIE53_005625 in Paraburkholderia graminis OAS925

Annotation: MHS family proline/betaine transporter-like MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 45 to 71 (27 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 106 to 124 (19 residues), see Phobius details amino acids 145 to 168 (24 residues), see Phobius details amino acids 180 to 199 (20 residues), see Phobius details amino acids 231 to 253 (23 residues), see Phobius details amino acids 271 to 289 (19 residues), see Phobius details amino acids 296 to 317 (22 residues), see Phobius details amino acids 325 to 350 (26 residues), see Phobius details amino acids 362 to 384 (23 residues), see Phobius details amino acids 391 to 409 (19 residues), see Phobius details PF00083: Sugar_tr" amino acids 13 to 209 (197 residues), 57.6 bits, see alignment E=1.2e-19 amino acids 231 to 418 (188 residues), 41.3 bits, see alignment E=9.7e-15 PF07690: MFS_1" amino acids 14 to 263 (250 residues), 50 bits, see alignment E=2.3e-17 amino acids 234 to 417 (184 residues), 39.8 bits, see alignment E=2.8e-14

Best Hits

Predicted SEED Role

"L-Proline/Glycine betaine transporter ProP" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (440 amino acids)

>ABIE53_005625 MHS family proline/betaine transporter-like MFS transporter (Paraburkholderia graminis OAS925)
MHRANRRSLAGGVIGTFVEWYDFVIYGLSAPVLAAHFFPKSVPTAALLGTFAIYAISYFA
RPLGGIVFGVVGDRIGRVNTLSTTVLLMGGATFGTGLLPYYEQVGIAAPVMLLACRVLQG
FSAGGETSGGFTYVIECAPKHRRGLWVSFGICAAVLPAVLVSLTILLVKAVIGSDDYFEW
GWRLPFLCGGLLSLVGLWLRRSLQDSDEFALAAFQRIRGVGPRHRIKASTTLVSTILIAV
QAVSGPLLVSYMYSYLTQVSKLSASTAMKTNIAAVLLLVIALPCFGALSDRIGRKAMMVC
GGFWLVLTAYPAMSLVSSGTVWSAFAGQALIAIGHAMFGAGGFVAVLELLPTSVRYTGHA
ISYNMAYAIFGGTAPIVFQTLVTTVGTPTAPSYYVIAIAALALIVIRFTPETQNVHLRDA
VEAESQTDNRPGKGPVHVSQ