Protein Info for ABIE53_005624 in Paraburkholderia graminis OAS925

Annotation: AAHS family 4-hydroxybenzoate transporter-like MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 57 to 80 (24 residues), see Phobius details amino acids 89 to 107 (19 residues), see Phobius details amino acids 113 to 135 (23 residues), see Phobius details amino acids 147 to 170 (24 residues), see Phobius details amino acids 177 to 197 (21 residues), see Phobius details amino acids 257 to 279 (23 residues), see Phobius details amino acids 292 to 312 (21 residues), see Phobius details amino acids 319 to 339 (21 residues), see Phobius details amino acids 345 to 369 (25 residues), see Phobius details amino acids 379 to 401 (23 residues), see Phobius details amino acids 407 to 428 (22 residues), see Phobius details PF07690: MFS_1" amino acids 28 to 394 (367 residues), 130.6 bits, see alignment E=6.6e-42 PF00083: Sugar_tr" amino acids 57 to 402 (346 residues), 48 bits, see alignment E=9.5e-17

Best Hits

KEGG orthology group: K08195, MFS transporter, AAHS family, 4-hydroxybenzoate transporter (inferred from 31% identity to rso:RSc1093)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (452 amino acids)

>ABIE53_005624 AAHS family 4-hydroxybenzoate transporter-like MFS transporter (Paraburkholderia graminis OAS925)
MANTVQIEKIVDEQQMTAFQIWMLAFSFLVLIVDSYDAYSIAYVAPSIIAEWKVPRVAFT
SVFTANVAGLAFGAILFGMLATRIGSRRVLFTSMLLFGFLTLAKTVVSSVLWLAIFQFLA
ALPVGGIYPIALSIVAEHTPLRRRAAMLVIVALGFAFGASLAGFIAAPVIQHLGWRWMFY
IGAAFPVILTTVAAPFVPESLRRLVQEGASRARVLIAVRRIAPSFTLPADAKFVTASPDQ
HAPFRQLFAGGRARMTILLWTGFITAYLVYYFLFSWIPVLLNAAGMSINQSLMGGAVYPA
GGFIAGLLFAYLSMKRSVPVITCMYFVVSALSLVSLAYANATIVAPILFVVGAGSIGGIL
AGNALVSLAYPAELRTTGLGWAFGLGRFGSMLGPLVGGVMLELRLPLGAMCMVLAVPALL
SAIAFYLVGKVNGLPGVQQDPALAYRTVDARD