Protein Info for ABIE53_005579 in Paraburkholderia graminis OAS925

Annotation: LacI family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 transmembrane" amino acids 64 to 85 (22 residues), see Phobius details PF00356: LacI" amino acids 13 to 58 (46 residues), 54.7 bits, see alignment 1.4e-18 PF00532: Peripla_BP_1" amino acids 72 to 286 (215 residues), 59.2 bits, see alignment E=9.8e-20 PF13407: Peripla_BP_4" amino acids 169 to 288 (120 residues), 37.5 bits, see alignment E=4.2e-13 PF13377: Peripla_BP_3" amino acids 182 to 341 (160 residues), 111.2 bits, see alignment E=1.2e-35

Best Hits

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 93% identity to bxe:Bxe_B2079)

Predicted SEED Role

"Transcriptional regulators"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (358 amino acids)

>ABIE53_005579 LacI family transcriptional regulator (Paraburkholderia graminis OAS925)
MKPAWVTENRVATLKDVAALAGVGMSTASRVISGKGPVSGDAAARVRAAIEQLNFRPSSI
GRAMATQSLGMIGIFVPTFFGSYYGTILKQTDTELRAVRRHVVVATGCGEVSPREQAIEA
VRFLIGRDCDGVVVISHDLHDEDLIMLHRMHPKMVFLNRAFDQFPEASFCADHRHGGELA
ARTLLDHGHREIAVISGPFTASDNMTRLEGFFAELARAGIARGDVTLIESDFSPEGGYAA
AQKLLDSKQRFTGLFCANDTMAVSALARFHQAGVSVPHELSVIGYDDDYSAAYAAPGLTS
VHIPTAELTQNAVRWLINQCYRTTWEIFREFPVSVTMRESVGPARGVEAVPTGESTQA