Protein Info for ABIE53_005461 in Paraburkholderia graminis OAS925

Annotation: membrane fusion protein (multidrug efflux system)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 transmembrane" amino acids 25 to 46 (22 residues), see Phobius details PF16576: HlyD_D23" amino acids 63 to 305 (243 residues), 46.5 bits, see alignment E=5.7e-16 PF13533: Biotin_lipoyl_2" amino acids 64 to 110 (47 residues), 44.7 bits, see alignment 1.9e-15 PF13437: HlyD_3" amino acids 229 to 315 (87 residues), 47.1 bits, see alignment E=7.1e-16

Best Hits

KEGG orthology group: K03543, multidrug resistance protein A (inferred from 91% identity to bpy:Bphyt_4416)

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (366 amino acids)

>ABIE53_005461 membrane fusion protein (multidrug efflux system) (Paraburkholderia graminis OAS925)
MSTTPSTIAPPSAAQTARPARRIPWMLLAIITVLAVLALAVSYWFFVGRFYETTDDAYVG
GDVTVMAPKVNGFVTNVLVRDNQFVHANDVLIQLDARDYDARLAQARAEVRSAQAAVIEL
QAKKSLQLATINQQAAEARASGAELTRSAADQTRYRELVKDDAVSNQVVERADADLVKAR
AAVDRSAAALTAAQRQIAVLDAQIGDAEARIATAQAAERVAALNVEYTTIRAPIDGYIGN
RTARVGVLASAGVPLLTVVPSGGLWIDANFKEDQLKKMRVGDSVDVDLDAFSTPIHGVVE
SLAPATGATFSVLPAENATGNFTKIVQRVPVRVHLTVPKNMEGALRPGLSATVKVHVDSG
KTPARG