Protein Info for ABIE53_005458 in Paraburkholderia graminis OAS925

Annotation: Mn2+/Fe2+ NRAMP family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 transmembrane" amino acids 14 to 38 (25 residues), see Phobius details amino acids 49 to 67 (19 residues), see Phobius details amino acids 88 to 107 (20 residues), see Phobius details amino acids 125 to 144 (20 residues), see Phobius details amino acids 152 to 169 (18 residues), see Phobius details amino acids 190 to 211 (22 residues), see Phobius details amino acids 231 to 255 (25 residues), see Phobius details amino acids 271 to 295 (25 residues), see Phobius details amino acids 327 to 346 (20 residues), see Phobius details amino acids 352 to 374 (23 residues), see Phobius details amino acids 387 to 411 (25 residues), see Phobius details PF01566: Nramp" amino acids 34 to 386 (353 residues), 202.2 bits, see alignment E=6.3e-64

Best Hits

KEGG orthology group: None (inferred from 93% identity to bug:BC1001_5503)

Predicted SEED Role

"Manganese transport protein MntH" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (416 amino acids)

>ABIE53_005458 Mn2+/Fe2+ NRAMP family transporter (Paraburkholderia graminis OAS925)
MTAEFLPGRVMKKLLEICLGVVTGVGGFLEMGSLATAVQGGAAFRFQPGWAILVGTVCLV
FLTEMAGRFSAVSRHTIADGIRDRFGVKFFLLPLIAVVLVNALVMSAEIGGVSVALEMAT
GIKHPWWAFPVALLAWCVLWRSTFGVIEKGTSLLGLVTLSFVAAAILLKPDWHQVARGLV
PSAPHHDPANYWFTVVSILGASITPSLYLFYSSGAIEDHWDRGYLGANRAIAGLGMAFGG
GISLAVLIAAAVVFPAHGITRVDDYQQLPLTLVAVFGFWGFVLFIASLAFACFGATLEMA
LEQAYFVAQGFGWNWGKNRKPRDDPGFSLVYTCALAISAIPIAAGADPLKLTVFSMALSA
FSLPLTVVPFLVLMNDESYVGRHRNGAFSNAVVTAIVALSFVLAIVTLPLQIAGGT