Protein Info for ABIE53_005430 in Paraburkholderia graminis OAS925

Annotation: ribose transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 transmembrane" amino acids 27 to 48 (22 residues), see Phobius details amino acids 55 to 75 (21 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 106 to 126 (21 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details amino acids 191 to 209 (19 residues), see Phobius details amino acids 240 to 262 (23 residues), see Phobius details amino acids 279 to 307 (29 residues), see Phobius details amino acids 316 to 335 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 53 to 332 (280 residues), 164.2 bits, see alignment E=1.8e-52

Best Hits

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 95% identity to bpy:Bphyt_5472)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (343 amino acids)

>ABIE53_005430 ribose transport system permease protein (Paraburkholderia graminis OAS925)
MLEITSGREQAIEKQARQRRRDLIQKFAALGSLAVLVVAFSLTSAAFFSVGNLLTVALQV
TSIAYLGVAATCVIITGGIDLSVGSVLALAGVAAALLVKAGVPVPVAMLGGMLVGAACGW
VNGICVTRMGLPPFIATLGMMLVARGVALQITGARPVSGLGDAFGELGNGALFKVSHIGA
DGFPDTVFPGIPYPVVIMVVLFVAVSILLSRTSLGRHIYAVGSNAEAARLSGVNVQGVKL
FTYVLSGVLAGATGCVLMSRLVTAQPNEGVMYELDAIASAVIGGTSLMGGVGTISGTAIG
AFVIGVLRNGLNMNGVSSFIQQIIIGVVILGTVWIDQLRNRKS