Protein Info for ABIE53_005413 in Paraburkholderia graminis OAS925

Annotation: type I restriction enzyme M protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 PF12161: HsdM_N" amino acids 6 to 137 (132 residues), 64.9 bits, see alignment E=1.9e-21 PF02384: N6_Mtase" amino acids 144 to 410 (267 residues), 195 bits, see alignment E=3e-61 PF01170: UPF0020" amino acids 178 to 299 (122 residues), 34.4 bits, see alignment E=2.9e-12

Best Hits

KEGG orthology group: K03427, type I restriction enzyme M protein [EC: 2.1.1.72] (inferred from 84% identity to tmz:Tmz1t_3181)

Predicted SEED Role

"Type I restriction-modification system, DNA-methyltransferase subunit M (EC 2.1.1.72)" in subsystem Restriction-Modification System (EC 2.1.1.72)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.72

Use Curated BLAST to search for 2.1.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (462 amino acids)

>ABIE53_005413 type I restriction enzyme M protein (Paraburkholderia graminis OAS925)
MLTGALRTQVDSIWNAFWSGGISNPLEVMEQITYLLFLRRLDDIHTLEERKATVTKKPMA
RRIFPDGSDSGGQPYDNMRWSRFKHFAAQDMFSLIDKHVFPFLRTMNADGSTYAHHMRDA
RFTIPTPGLLAKVVDMLDHVPMEDRDTKGDLYEYMLGKIASAGQNGQFRTPRHIIQLMVE
LTAPVPADVICDPASGTCGFLVAAGEYLRDKHPAMLRNAAQREHFHHGMFHGYDFDNTML
RIGSMNMALHGVDNPDVRYKDSLAQGHAEDDEKYSLILANPPFAGSLDYENTAKDLLSIV
KTKKTELLFLALFLRLLKPGGRAAVIVPDGVLFGSSKAHKELRRLIVEDQKLDAIVSLPS
GVFKPYAGVSTAILLFTKTNSGGTDHVWFYDMKADGRSLDDKRQPLLSEDKLGVAPATPL
TDAEHEKNNPAGCACAVEIARDHGASAGAYGTELLRAEGGNR