Protein Info for ABIE53_005362 in Paraburkholderia graminis OAS925

Annotation: glycosyltransferase involved in cell wall biosynthesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 PF13439: Glyco_transf_4" amino acids 14 to 189 (176 residues), 43.5 bits, see alignment E=5.5e-15 PF00534: Glycos_transf_1" amino acids 196 to 348 (153 residues), 83 bits, see alignment E=2.8e-27 PF13692: Glyco_trans_1_4" amino acids 202 to 331 (130 residues), 71 bits, see alignment E=2e-23

Best Hits

KEGG orthology group: None (inferred from 97% identity to bug:BC1001_5445)

MetaCyc: 60% identical to GDP-Man:alpha-D-Gal-diphosphoundecaprenol alpha-1,3-mannosyltransferase (Salmonella enterica enterica serovar Newport)
RXN-21846 [EC: 2.4.1.379]

Predicted SEED Role

"Glycosyltransferase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.379

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (395 amino acids)

>ABIE53_005362 glycosyltransferase involved in cell wall biosynthesis (Paraburkholderia graminis OAS925)
MKVAIVHDWLVVSGGAEKVLKNIIECFPKADVFSIVDFLEDRDCVKGKPVNTSFIQKMPF
ARKRYRAYLPLMPIAIEQLDLSAYDLVISSSHAVAKGVLTGPNQIHISYVHSPIRYAWDL
QHQYLRESHLNKGVKSIMARALLHYIRGWDSRSANGVDHLLANSHFIARRIKKAYQRDAT
VIYPPVDLDNMVMCTQKENFYVTASRMVPYKRIDLIVRAFSQTPERRLVVIGDGPEMKRI
KATAGPNVTILGHQPLEVLVDHLRRARAFVFAAEEDFGISVVEAQACGTPVIAFGRGGAL
ESVIGLPLEQPTGVFFGEQTAESLLEAVTRFERNASLFDPVNCRQNAERFSTENFKTALT
DFIDARLLRSSIEQLRPYLVRERTAEERHLASMPS