Protein Info for ABIE53_005344 in Paraburkholderia graminis OAS925

Annotation: two-component system nitrate/nitrite sensor histidine kinase NarX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 644 transmembrane" amino acids 13 to 36 (24 residues), see Phobius details amino acids 164 to 189 (26 residues), see Phobius details PF13675: PilJ" amino acids 33 to 129 (97 residues), 72 bits, see alignment E=8.7e-24 PF00672: HAMP" amino acids 190 to 237 (48 residues), 45 bits, see alignment 2.2e-15 PF07730: HisKA_3" amino acids 428 to 494 (67 residues), 51 bits, see alignment E=3.5e-17 PF02518: HATPase_c" amino acids 536 to 626 (91 residues), 51.5 bits, see alignment E=2.6e-17

Best Hits

KEGG orthology group: K07673, two-component system, NarL family, nitrate/nitrite sensor histidine kinase NarX [EC: 2.7.13.3] (inferred from 57% identity to bgf:BC1003_4840)

Predicted SEED Role

"Nitrate/nitrite sensor protein (EC 2.7.3.-)" in subsystem Nitrate and nitrite ammonification (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (644 amino acids)

>ABIE53_005344 two-component system nitrate/nitrite sensor histidine kinase NarX (Paraburkholderia graminis OAS925)
MRPVSSWPLTTKLAVVVATLLALALASIGVTLWITLQLDGGAAAINEAGRMRMQTYRAAL
MLREAPERIDALATQFDRSLELLRVGDPARPLSVPWNDEARARFANVQRQWQALRPIWID
AAKARDAPSSASTDVLREANTFVEMIDAFDTSIEAQLARWTSILNVVQIALLVLAIGSAW
ALLYIGHLLVLEPVSRLTGGLARIEEGDFSMRVQVASHDEFGQLSAGFNRMARNLQQFYA
ELEQKVSEKTASLETERARLAALYEISAFAAEASTLDVLAHGFARRMRGIAGADSVAIRW
SDEGNERYLLLGSDGLPRFMIEDEQCLTSRSCLCGEPRTEPGARVIPVLAEGAAILGHCA
RAGYATLVSVPVILHQRPLGEIDLFFSDEIALSAQDRDLFDALSSHLATAMENLRVTALE
REAAVSGERALLASELHDSIAQSLAFLKIQVQLLRDALPAHTDASVARIVDELDAGVRES
TGDVRELLVHFRTRGNAEDMEPALRTTLRKFEHQTGLTTHLSMQGHGLPLDADVKVQVLH
VLQEALSNVRKHARAREVWLEVQQTPAWSFEVRDDGQGFDAARDTLGETHVGMRIMRERA
ARIGARVVVESVPGEGTCVTLTLPQHRGDTCMRTNQPVYKGRTI