Protein Info for ABIE53_005343 in Paraburkholderia graminis OAS925

Annotation: cytochrome o ubiquinol oxidase operon protein cyoD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 110 transmembrane" amino acids 18 to 38 (21 residues), see Phobius details amino acids 48 to 69 (22 residues), see Phobius details amino acids 80 to 101 (22 residues), see Phobius details TIGR02847: cytochrome o ubiquinol oxidase subunit IV" amino acids 13 to 108 (96 residues), 115.4 bits, see alignment E=6.6e-38 PF03626: COX4_pro" amino acids 21 to 93 (73 residues), 54.7 bits, see alignment E=5.5e-19

Best Hits

Swiss-Prot: 47% identical to CYOD_PSEAE: Cytochrome bo(3) ubiquinol oxidase subunit 4 (cyoD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02300, cytochrome o ubiquinol oxidase operon protein cyoD (inferred from 92% identity to bgf:BC1003_3979)

MetaCyc: 41% identical to cytochrome bo3 subunit 4 (Escherichia coli K-12 substr. MG1655)
RXN-21817 [EC: 7.1.1.3]

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit IV (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (110 amino acids)

>ABIE53_005343 cytochrome o ubiquinol oxidase operon protein cyoD (Paraburkholderia graminis OAS925)
MAHMQSLSVDQGHGSLRGYLAGFVLSVVLTAAAFWLVMHGAFPAQTAMIALSVLAFVQIV
VHLVFFLHIDMSAGQRWNVMALAYTALAALFLIGGTVWVMHNVSMNMMSR