Protein Info for ABIE53_005342 in Paraburkholderia graminis OAS925
Annotation: cytochrome o ubiquinol oxidase subunit 3
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 64% identical to CYOC_PSEPU: Cytochrome bo(3) ubiquinol oxidase subunit 3 (cyoC) from Pseudomonas putida
KEGG orthology group: K02299, cytochrome o ubiquinol oxidase subunit III [EC: 1.10.3.-] (inferred from 92% identity to bgf:BC1003_3980)MetaCyc: 63% identical to cytochrome bo terminal oxidase subunit III (Pseudomonas putida KT2440)
RXN0-5268 [EC: 7.1.1.3]
Predicted SEED Role
"Cytochrome O ubiquinol oxidase subunit III (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)
MetaCyc Pathways
- NADH to cytochrome bo oxidase electron transfer I (2/2 steps found)
- glycerol-3-phosphate to cytochrome bo oxidase electron transfer (2/2 steps found)
- proline to cytochrome bo oxidase electron transfer (2/2 steps found)
- pyruvate to cytochrome bo oxidase electron transfer (2/2 steps found)
- succinate to cytochrome bo oxidase electron transfer (2/2 steps found)
- D-lactate to cytochrome bo oxidase electron transfer (1/2 steps found)
- NADH to cytochrome bo oxidase electron transfer II (1/2 steps found)
Isozymes
Compare fitness of predicted isozymes for: 1.10.3.-
Use Curated BLAST to search for 1.10.3.- or 7.1.1.3
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (202 amino acids)
>ABIE53_005342 cytochrome o ubiquinol oxidase subunit 3 (Paraburkholderia graminis OAS925) MSNNTLSVSLDGGHGNHGSSDTVFGFWLYLMTDCVLFASLFAVFAVMSNQFAGGPSGKDL FDIGGVAVETAALLLSSITYGFAMLAARRGKSTAVLAWLAVTFVLGLAFLALEMREFSHL IAEGAGPARSAFLSAFFTLVGTHGLHVTVGLVWMAVLAVQILRGPGLSERQFTRLACLSL FWHFLDIVWICVFSFVYLGSVL