Protein Info for ABIE53_005174 in Paraburkholderia graminis OAS925

Annotation: D-galactonate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 transmembrane" amino acids 31 to 49 (19 residues), see Phobius details amino acids 68 to 87 (20 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details amino acids 125 to 148 (24 residues), see Phobius details amino acids 159 to 181 (23 residues), see Phobius details amino acids 194 to 216 (23 residues), see Phobius details amino acids 262 to 282 (21 residues), see Phobius details amino acids 294 to 315 (22 residues), see Phobius details amino acids 327 to 347 (21 residues), see Phobius details amino acids 353 to 372 (20 residues), see Phobius details amino acids 384 to 406 (23 residues), see Phobius details amino acids 418 to 438 (21 residues), see Phobius details PF07690: MFS_1" amino acids 39 to 403 (365 residues), 168.7 bits, see alignment E=1.8e-53 PF00083: Sugar_tr" amino acids 63 to 436 (374 residues), 45.1 bits, see alignment E=7.1e-16

Best Hits

Swiss-Prot: 48% identical to NICT_PSEPK: Putative metabolite transport protein NicT (nicT) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 97% identity to bug:BC1001_5273)

Predicted SEED Role

"Major facilitator family transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (444 amino acids)

>ABIE53_005174 D-galactonate transporter (Paraburkholderia graminis OAS925)
MSSYQAVSGQPIAAALGQPGAAEIERTYKKVFWRIVPFLMLCYVVAYLDRVNVGFAKLQM
SQDLAFSETVFGLGAGVFFIGYFLFELPSNILMHKLGARIWIARIMITWGVMSALFVFVK
TPAQFYILRFLLGLAEAGFYPGVILYLTYWFPSHRRAKIIAVFMSAIPVSGIFGNPLSGW
IMQSFHNSSGLAGWQWMFLIEAVPAVAIGIATILYLDNGIASAKWLSEPEKRLLSDEIAA
SQPKEKANAHSLRAVFRDPRTWWMSLIYFAFVTGQYGLTFWMPTLIKSTGVSGSFNIGLL
SAIPFLCAIVVMNLMGHSADKRRERRWHLIVPALFGAVGFTVAASFASNTVVSIAFLSLA
AAGVLTCAPLFWSLPTAFMSGATAAAGIAIINSIGNLAGFASPYMIGYLKDLTHSTQSGM
YVLAGMLVIGAIATWLTPAKLVNR