Protein Info for ABIE53_005171 in Paraburkholderia graminis OAS925

Annotation: putative dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF02826: 2-Hacid_dh_C" amino acids 3 to 94 (92 residues), 30.5 bits, see alignment E=6e-11 PF03446: NAD_binding_2" amino acids 4 to 161 (158 residues), 139.8 bits, see alignment E=2.1e-44 PF02737: 3HCDH_N" amino acids 4 to 43 (40 residues), 23.9 bits, see alignment 8.8e-09 PF03807: F420_oxidored" amino acids 5 to 66 (62 residues), 25 bits, see alignment E=6e-09 PF14833: NAD_binding_11" amino acids 167 to 286 (120 residues), 132.9 bits, see alignment E=1.8e-42

Best Hits

Swiss-Prot: 85% identical to LTND_CUPNH: L-threonate dehydrogenase (ltnD) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: None (inferred from 97% identity to bgf:BC1003_4151)

MetaCyc: 55% identical to L-threonate 2-dehydrogenase (Haemophilus influenzae Rd KW20)
RXN-18590 [EC: 1.1.1.411]

Predicted SEED Role

"3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31)" in subsystem Isobutyryl-CoA to Propionyl-CoA Module or Valine degradation (EC 1.1.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.31

Use Curated BLAST to search for 1.1.1.31 or 1.1.1.411

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (296 amino acids)

>ABIE53_005171 putative dehydrogenase (Paraburkholderia graminis OAS925)
MSRNVGVIGLGAMGLGVARSLLRAGFRVHACDLRGEVLQAFVKEGGVGCASPAELGAQCE
VVVTLVVNAAQTEAVLFGAQGAVSAMKPGGVVIASATVAPDFAIELGKRVEAAGLQMLDA
PVSGGAARAASGEMTMMTSGPAAAYAACEDVLAKMAGKVYRLGSAHGAGSKVKIINQLLA
GVHIAVAAEAMALGLREGVDPDALYDVITHSAGNSWMFENRVPHILNGDYTPLSAVDIFV
KDLGLVLDTARRSKFPLPLSAAAHQMFMMASTAGHGGEDDSAVIKIFPGIDVPAAK