Protein Info for ABIE53_005120 in Paraburkholderia graminis OAS925

Annotation: NAD-dependent SIR2 family protein deacetylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 237 to 248 (12 residues), see Phobius details PF02146: SIR2" amino acids 45 to 247 (203 residues), 150.9 bits, see alignment E=1.9e-48

Best Hits

Swiss-Prot: 60% identical to NPD_BORBR: NAD-dependent protein deacetylase (cobB) from Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)

KEGG orthology group: None (inferred from 89% identity to bug:BC1001_5222)

MetaCyc: 47% identical to NAD-dependent lipoamidase SIRT4 (Homo sapiens)
RXN-22964 [EC: 2.3.1.313]

Predicted SEED Role

"NAD-dependent protein deacetylase of SIR2 family" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate or Redox-dependent regulation of nucleus processes

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.313

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>ABIE53_005120 NAD-dependent SIR2 family protein deacetylase (Paraburkholderia graminis OAS925)
MTDLRSAPVESSQALEALEAVSASHTLDDLHDFVQRYPRLFVLTGAGISTDSGIPGYRDD
NGEWKRSPPITLQEFLGGDAMRRRYWARSMVGWPVVAQAQPNAAHTALARLEAAGHVPTL
VTQNVDGLHQRAGSRQVIELHGGIDGVICLDCGTQHSRASIQQTLEADNPALRSVTAEAA
ADGDAHLEWHALETFRVPACANCGGLLKPAVVFFGESVPRERVEAASHALDAADAVLVVG
SSLMVYSGYRFCLWAQKQRKPIAAINLGRTRADPLLSLKIAAPCADMLTALAGRLAVD