Protein Info for ABIE53_005048 in Paraburkholderia graminis OAS925

Annotation: tetratricopeptide (TPR) repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 529 PF13432: TPR_16" amino acids 21 to 77 (57 residues), 15.8 bits, see alignment 9e-06 amino acids 109 to 150 (42 residues), 21.8 bits, see alignment 1.2e-07 amino acids 163 to 210 (48 residues), 23.2 bits, see alignment 4.1e-08 PF07721: TPR_4" amino acids 119 to 142 (24 residues), 17.3 bits, see alignment (E = 3e-06) PF07719: TPR_2" amino acids 119 to 150 (32 residues), 24.4 bits, see alignment (E = 1.2e-08) PF13181: TPR_8" amino acids 121 to 150 (30 residues), 15.6 bits, see alignment (E = 8e-06) PF13414: TPR_11" amino acids 130 to 165 (36 residues), 34 bits, see alignment 1.1e-11 PF01075: Glyco_transf_9" amino acids 436 to 467 (32 residues), 24.9 bits, see alignment (E = 6.5e-09)

Best Hits

KEGG orthology group: None (inferred from 84% identity to bug:BC1001_5161)

Predicted SEED Role

"FOG: TPR repeat"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (529 amino acids)

>ABIE53_005048 tetratricopeptide (TPR) repeat protein (Paraburkholderia graminis OAS925)
MQSPTPLSSEVSSEVISLWFNEAEEARVAGRLDTAQALLDRIIMHDSTHAGALYARGLVA
LASDQLPLAQRWIERAIEVEPQPPFFDMLCLVQIKLRMFASIAQTAKAGLVHQPDSLPLH
YYLGVALQLQGRADEAAAVYRRLIELKPDYAQAHANLGVVVKDLGSLSDAERHIRQAIAL
DPANRGARASLSLVLLAAGRYEEAWPYFEERTANFVDARGQPASQAPQLPLPQWKGERPD
AVGGAHGLNASGARLLVLPEQGHGDSLQFVRYLPLALERFAQVGYICPPSLRRLYEESLC
ARWPGLVMLDDVMPDISQWDWQCPLMSLPRAFGTRLDNIPADAYLYADPQRSATWRARLD
ALPQQGLPRVGVVWAGGHSGLTEDRARSLSSAQMAPLFASSPLRWISLQKTDDLAKRPSA
ATKPYLTDWMDEVADFADTAAIIDNLDLVISVDTSVAHLAAAMGKPVWLLNRFAGCWRWL
RDREDSPWYPGVRIFTQPERDNWTDVIARIADELKRRYELGKTYGSFVR