Protein Info for ABIE53_005041 in Paraburkholderia graminis OAS925

Annotation: propionate catabolism operon transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 656 TIGR02329: propionate catabolism operon regulatory protein PrpR" amino acids 9 to 653 (645 residues), 797.8 bits, see alignment E=2.3e-244 PF06506: PrpR_N" amino acids 35 to 198 (164 residues), 165.4 bits, see alignment E=3.7e-52 PF08448: PAS_4" amino acids 209 to 256 (48 residues), 25.3 bits, see alignment 6.2e-09 PF00158: Sigma54_activat" amino acids 326 to 493 (168 residues), 232.1 bits, see alignment E=1.2e-72 PF14532: Sigma54_activ_2" amino acids 327 to 498 (172 residues), 70.9 bits, see alignment E=5.2e-23 PF07728: AAA_5" amino acids 350 to 469 (120 residues), 31.3 bits, see alignment E=7.9e-11 PF02954: HTH_8" amino acids 617 to 652 (36 residues), 34.3 bits, see alignment 6.6e-12

Best Hits

KEGG orthology group: K02688, transcriptional regulator, propionate catabolism operon regulatory protein (inferred from 94% identity to bug:BC1001_5154)

Predicted SEED Role

"Propionate catabolism operon regulatory protein PrpR" in subsystem Methylcitrate cycle

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (656 amino acids)

>ABIE53_005041 propionate catabolism operon transcriptional regulator (Paraburkholderia graminis OAS925)
MSTPSFDTARRPRIWALSISRLRDLFIDIAGEYVERADLRIVAQGFEDAVREIDAAGAGR
PDVVIAGGSNGAYLKTRVAVPVVMITPTGFDVMHALARARRDGAKVALVTHGKTPDEVRR
FVTAFGLDVTFASHQSAQDAESVVLDLRDRGIDVVVGPGLVTDLAAHAGMGAVFLYSRDS
VRAGFDTALEVAQATRRETIRRQRLDNLLQHLRDGVVALDAEGRVEAMNQRLAAVLGVDA
ANAAGRALLELAPDLAGSLPDSDGDAFCTVRGASYVVHRGPLASGGAAAGTVLTFQESRA
VERLDRTLRSRQRVQQFSARYRLEDMVGAAESMQRVRALVQRYARSDATVLILGESGTGK
EMVAQSMHQLSARRDFAFVAINCGAFPEALLESELFGYEEGAFTGARKGGKAGLIEVAHR
GTLFLDEIGEMPLSLQSRLLRVLQEREVVRLGSTEPTRVDIRVVAATHRALTEGIEAGRF
RADLYYRLNILSIALPPLRERPTDLLPLAAELLLQAAAREPRLAARLPDAAAAERILAAL
AEPLRRYAWPGNVRELQNVIERIAVELAEMESDADSPAQTQPLITRDMLRTIAPEIVEPQ
QPRTQKTALTLRERSRHVEADEIRAALAAHDGDRDAVCDALGISKTTLWRKLNGAR