Protein Info for ABIE53_004997 in Paraburkholderia graminis OAS925

Annotation: tight adherence protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details amino acids 268 to 288 (21 residues), see Phobius details amino acids 300 to 319 (20 residues), see Phobius details PF00482: T2SSF" amino acids 160 to 279 (120 residues), 62.2 bits, see alignment E=2.4e-21

Best Hits

KEGG orthology group: K12510, tight adherence protein B (inferred from 86% identity to bgf:BC1003_4367)

Predicted SEED Role

"Flp pilus assembly protein TadB" in subsystem Widespread colonization island

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (327 amino acids)

>ABIE53_004997 tight adherence protein B (Paraburkholderia graminis OAS925)
MNPIFYAFAFLLFIAVVLGIEGIYQWWNSHHGPAARRLDQRIRALSAGAHANGERLSILK
ERMLSNSASVHALMMRVPRIHLLDRIILQSGSSLTVGRLATHSVVALVLVPLAANFSPVQ
VPTLVTVLAAVAALAFPTLRMLRARRKRLRVLERQLPEAADMISRALRAGHSFSSALGML
GSEFAEPMAGEFRIVFDEINYGVTLNEALLNLATRVPVGDLRYFVIAVLIQRETGGNLAE
ILDSIASLVRARLQLFDKVRVLSAEGRLSGWILALLPFASAGAMQVVNPTFFSVLWEDPA
GLQIIEMMLVSMVLGILWMRRIVQIRV