Protein Info for ABIE53_004992 in Paraburkholderia graminis OAS925

Annotation: ATP-binding cassette subfamily B protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 609 transmembrane" amino acids 45 to 65 (21 residues), see Phobius details amino acids 83 to 102 (20 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details amino acids 271 to 294 (24 residues), see Phobius details PF00664: ABC_membrane" amino acids 49 to 307 (259 residues), 67.3 bits, see alignment E=1.8e-22 PF00005: ABC_tran" amino acids 380 to 529 (150 residues), 110.1 bits, see alignment E=1.4e-35

Best Hits

KEGG orthology group: None (inferred from 92% identity to bgf:BC1003_4372)

Predicted SEED Role

"Transport ATP-binding protein CydCD" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (609 amino acids)

>ABIE53_004992 ATP-binding cassette subfamily B protein (Paraburkholderia graminis OAS925)
MELVDHSDRGRASRVRGRRHSRVLSRYAGRPIRLIWRYIARRKTAHAIVLASVVAAVGFA
LASQYGIRNLIDALPQGRAHPQTVAYAFAVLVGLIFADNLMWRVAGWVSSRAFVRVTGDI
RQDMFDYLMGHAPTFFADKQPGVLSSRVSATANAVYVIENTVAWTALPPTLTVIGAIVMV
ATVSLPMSIALVAISALLTACLFWLARKGTSRHEAFASQAASVDGELVDVIGNMGLVRAF
SAVPAELRRFDGHLEAEAVARRRSLLYLEKLRLVHAFATALLSAALLGWTIWLWTQGRAT
TGDVVLVGSLGFAILHGSRDVAVAFVDLTQHVARLAEASQTLLTPHAMPEAPKAIPLIVR
EATVDFDNVSFAYPGRRRVLSDLTLHIEAGERVGLVGPSGAGKSTVLALLQRFYDPANGC
VRISDQDISYVTLQSLQAAISVVPQDVTLFHRSLLDNIRYGCPDATEADVKRACEDASCM
DFIAALPDGLNTIAGDRGTKLSGGQRQRIAIARAILKDSPILLLDEATSALDTASEIVIQ
AALERLMKNRTVIAIAHRLSTLQSFDRIIVMNRGRVVQEGTPAKLAMVPGIYRDTLARHN
RRTPAPTMN