Protein Info for ABIE53_004977 in Paraburkholderia graminis OAS925

Annotation: subfamily B ATP-binding cassette protein HlyB/CyaB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 716 transmembrane" amino acids 160 to 183 (24 residues), see Phobius details amino acids 197 to 218 (22 residues), see Phobius details amino acids 271 to 292 (22 residues), see Phobius details amino acids 298 to 321 (24 residues), see Phobius details amino acids 369 to 384 (16 residues), see Phobius details amino acids 394 to 420 (27 residues), see Phobius details PF03412: Peptidase_C39" amino acids 16 to 136 (121 residues), 48.8 bits, see alignment E=9.5e-17 TIGR01846: type I secretion system ATPase" amino acids 19 to 712 (694 residues), 1006.7 bits, see alignment E=2.7e-307 PF00664: ABC_membrane" amino acids 164 to 425 (262 residues), 178.1 bits, see alignment E=4.7e-56 PF00005: ABC_tran" amino acids 492 to 641 (150 residues), 115.3 bits, see alignment E=5.1e-37

Best Hits

Swiss-Prot: 60% identical to RTX1B_ACTPL: Toxin RTX-I translocation ATP-binding protein (apxIB) from Actinobacillus pleuropneumoniae

KEGG orthology group: K11004, ATP-binding cassette, subfamily B, bacterial HlyB/CyaB (inferred from 78% identity to bgl:bglu_1p0220)

Predicted SEED Role

"cyclolysin secretion ATP-binding protein" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (716 amino acids)

>ABIE53_004977 subfamily B ATP-binding cassette protein HlyB/CyaB (Paraburkholderia graminis OAS925)
MNAPDHRTPAESTPAADPGLACLVVIARFHGIAADAGQLRHAAASGNEPYSMDTLVLSAR
SLGLKARVAPLRTERLARTPLPALALDCNGEHFVIARVEGGGALVLEAGAPTPAVVPLDA
LEARSTGRMILFASRASLAGELARFDFSWFIPAVVKYRRLLLEVLAVSFVLQLFGLVSPL
MFQVVMDKVLVNRTYNTLAVVGVALFACSTFEVVLTGLRNYLFSHTTNRIDVELGARLFR
HLVALPLNYFAARRVGDTVARVRELENIRNFLTGQALTAVIDLLFSVVFIVVMCFYSVWL
TLVVVISLPAYVGISMALVPTLRQRLNEKFARGADNQSFLVEIVSGVETVKAMAVEPQFT
KKWETQLAAYVAAGFRVTALGNVGQQMIQYVGKLVSLATLLLGAKLVIDGGLTVGGLIAF
NMMSQRVAAPVLRLAQLWQDFQQTGISMSRLGDILNSRTELPPSRQALPAVRGDIRFEQI
RFRYQPDSPPVLDGVSLDIRAGEVIGIVGRSGSGKRTLTKLLQRLYLPEHGTVRIDGIDL
ALADPASLRRQVGVVLQENLLFNRTVRENIALTDPGAPLEAVMRVARLAGAHDFISELPH
GYDTRIEEHGGNLSGGQRQRLAIARALLTNPRILIFDEATSALDFETERVIQNNMKAICA
GRTVIIIAHRLTAVRHADQIIAMDRGKIVERGRHDELLEKRGYYAHLVSLQNGYAS