Protein Info for ABIE53_004964 in Paraburkholderia graminis OAS925

Annotation: branched-chain amino acid transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 transmembrane" amino acids 7 to 30 (24 residues), see Phobius details amino acids 36 to 58 (23 residues), see Phobius details amino acids 70 to 92 (23 residues), see Phobius details amino acids 116 to 135 (20 residues), see Phobius details amino acids 156 to 185 (30 residues), see Phobius details amino acids 197 to 226 (30 residues), see Phobius details amino acids 237 to 258 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 1 to 250 (250 residues), 104 bits, see alignment E=3.9e-34

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 96% identity to bug:BC1001_5095)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>ABIE53_004964 branched-chain amino acid transport system permease protein (Paraburkholderia graminis OAS925)
MSIVFGLLRFVNFAHGAFYLLGAYFCYQAMQWSLNFWTALVVVPIAVGALAWVVEKLILR
HVYAQQHEFHILVTVGLALVVQECAILVWGPLGDNVPVPDMLNGVVIWGSFVYPKYRLFV
IGFTAVLAALLWWVLEGTRLGSAVRAGSESTEMVSLLGINVLRVFSLVFALGAATAALAG
VLAAPIRGVDPFMGIEALGVAFVVVVVGGMGNFLGALVGGLLVGIVQSVMSTLWPEGARL
MIYVAMAAVLLLRPNGLLGRAA