Protein Info for ABIE53_004940 in Paraburkholderia graminis OAS925

Annotation: signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 552 PF00512: HisKA" amino acids 195 to 256 (62 residues), 32.1 bits, see alignment E=1.4e-11 PF02518: HATPase_c" amino acids 301 to 416 (116 residues), 78.9 bits, see alignment E=5.8e-26 PF00072: Response_reg" amino acids 439 to 546 (108 residues), 71.8 bits, see alignment E=8.1e-24

Best Hits

KEGG orthology group: None (inferred from 92% identity to bug:BC1001_5077)

Predicted SEED Role

"Sensory box sensor histidine kinase/response regulator (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (552 amino acids)

>ABIE53_004940 signal transduction histidine kinase (Paraburkholderia graminis OAS925)
MEQRVLILAPFGRDADVIAEVLSKDKRTCVAFSDADALTEALDAGVGTALIAEEALADSR
ATRLFEWLEHQPAWSDLPFILLAATRVGHRSARGLEVLERLGNVVVLERPLNSETLRRAV
ASALRARARQYESRRHLAERIEAQEALVQLNDSLESRIAERTHELASANNRLMMEIHERA
KVQAVLVQSQKMEALGQLTGGIAHDFNNLLNVIMVNSELIARVSGDERIRGMAATVKRAT
ERGAKLTGQLLTFSRNSNLDLKAVDVVTLLQGMRDIITVSLGSGISYSNDFERKEMWTHA
DANQLELAVLNLAINARDAMPGGGELSVRVKERTAPDQTLAEGRYVVIEVADTGAGVPPD
LVTRVFDPFFTTKPIGKGTGLGLSQVYGIARQAGGTARLFSQEGVGTTVELWLPLRERVA
PQNAKTSDTEANAVGEKRVLVIEDDSEVRAMLVESLKMLGYNVTEAPDGRAGLARLADDN
PDLLMVDFAMPGMNGIDVIAEARKMRSDLPVILATGYADVDISGLSVERCTVLRKPFQLD
DLARTVRLGLIG