Protein Info for ABIE53_004855 in Paraburkholderia graminis OAS925

Annotation: thiosulfate/3-mercaptopyruvate sulfurtransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 PF00581: Rhodanese" amino acids 15 to 134 (120 residues), 56.8 bits, see alignment E=1.3e-19 amino acids 166 to 277 (112 residues), 43.8 bits, see alignment E=1.5e-15

Best Hits

Swiss-Prot: 51% identical to THTM_PSEAE: Probable 3-mercaptopyruvate sulfurtransferase (sseA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01011, thiosulfate/3-mercaptopyruvate sulfurtransferase [EC: 2.8.1.1 2.8.1.2] (inferred from 96% identity to bgf:BC1003_4544)

Predicted SEED Role

"Thiosulfate sulfurtransferase, rhodanese (EC 2.8.1.1)" (EC 2.8.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.1 or 2.8.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (289 amino acids)

>ABIE53_004855 thiosulfate/3-mercaptopyruvate sulfurtransferase (Paraburkholderia graminis OAS925)
MPHTHYTTLISATNLAERLAEAPGSVFVIDCRFDLADPEAGEKAYLAGHLPGAHYLHLDR
DLSGPKTGTNGRHPLPDRERLVETLESRGLKQGQQVVAYDAQGGMYAARAWWLLRWLGHD
AVALLDGGLQAWEAAGQPLTQDVPPQNTGDFKAGAPLSVTVDAHMIERNLGSKERVVVDA
RAADRYRGENETLDRVGGHIPGALNRFFKDNLTADGRFKPAHTLRDEFHVLLGDTPPEHV
VLQCGSGVTACVNALAMEVAGLHGAALYAGSWSEWSSDPKRPVATGPKP