Protein Info for ABIE53_004781 in Paraburkholderia graminis OAS925

Annotation: erythritol transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 transmembrane" amino acids 34 to 52 (19 residues), see Phobius details amino acids 64 to 84 (21 residues), see Phobius details amino acids 90 to 108 (19 residues), see Phobius details amino acids 120 to 143 (24 residues), see Phobius details amino acids 149 to 169 (21 residues), see Phobius details amino acids 196 to 218 (23 residues), see Phobius details amino acids 249 to 270 (22 residues), see Phobius details amino acids 278 to 296 (19 residues), see Phobius details amino acids 303 to 322 (20 residues), see Phobius details amino acids 328 to 347 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 65 to 342 (278 residues), 158.1 bits, see alignment E=1.2e-50

Best Hits

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 66% identity to hel:HELO_3968)

MetaCyc: 53% identical to putative erythritol ABC transporter membrane protein (Brucella abortus 2308)
7.5.2.-

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (360 amino acids)

>ABIE53_004781 erythritol transport system permease protein (Paraburkholderia graminis OAS925)
MTTQNSSTPSIQPVHGKHNRQSAYMASRMAVNLLKLRIFIALFAIIIVFSLATENFLSTS
NMLIMAKHVTIVAILSIGMTLVILTGGIDLSVGSIVGISGMAAGYLLLEGVKIDHHVVFF
NPWGVTLIACALGAIIGAVNGYLITALNVAPFIATLGMLYVVRGAALLVNNGSTFADLGG
NPALGNTGFEFLGNGTILGLSMPVWILVILAAITIFVARRTPLGRRIYAIGGNEQAARFS
GIRTNRVKLFVYMFSGFCAAIVGLVITAQLQTAHPLTGQTFELNAIAAVVLGGTALMGGR
GTVFGSVVGACVISILGDGMVMCGISDFWQMVIKGLVIIFAVVIDQLQQRLQSRMVSLTA