Protein Info for ABIE53_004777 in Paraburkholderia graminis OAS925

Annotation: NAD(P)-dependent dehydrogenase (short-subunit alcohol dehydrogenase family)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 transmembrane" amino acids 24 to 42 (19 residues), see Phobius details PF00106: adh_short" amino acids 22 to 215 (194 residues), 163.4 bits, see alignment E=7e-52 PF08659: KR" amino acids 25 to 178 (154 residues), 46.6 bits, see alignment E=5.6e-16 PF13561: adh_short_C2" amino acids 32 to 263 (232 residues), 202.2 bits, see alignment E=1.5e-63

Best Hits

Swiss-Prot: 35% identical to Y182_METEA: Uncharacterized oxidoreductase MexAM1_META1p0182 (MexAM1_META1p0182) from Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1)

KEGG orthology group: None (inferred from 64% identity to ddd:Dda3937_01335)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (265 amino acids)

>ABIE53_004777 NAD(P)-dependent dehydrogenase (short-subunit alcohol dehydrogenase family) (Paraburkholderia graminis OAS925)
MAIQYDMSLRHGVDFDFRLDGKVAVVTGGLGGIAMATNAALIAKGARVAIFYPSFEEPRV
QAAIEELGAANARAFPCDVANEADVEKAMKAALSHFGDLHLLVNAAGCITLTAAEDIAVD
EWQQQIGVNLTGPFLCAKHFARHVLASGHGGKIVNIASQAATVAIDKHCAYTSAKAGLIG
MTKVLAKEWALRGITVNTVSPTVVLTPMGAAAWEGEKGEAMKKLIPVGRFAYTDEIAAAI
LFLLSNGADMITGADIMIDGGYTIC