Protein Info for ABIE53_004621 in Paraburkholderia graminis OAS925

Annotation: phenylpropionate dioxygenase-like ring-hydroxylating dioxygenase large terminal subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 PF00355: Rieske" amino acids 26 to 119 (94 residues), 76.4 bits, see alignment E=1.3e-25 PF19112: VanA_C" amino acids 162 to 334 (173 residues), 86.7 bits, see alignment E=2.3e-28

Best Hits

KEGG orthology group: None (inferred from 94% identity to bgf:BC1003_5019)

Predicted SEED Role

"Phenylpropionate dioxygenase and related ring-hydroxylating dioxygenases, large terminal subunit" in subsystem Phenylpropanoid compound degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (359 amino acids)

>ABIE53_004621 phenylpropionate dioxygenase-like ring-hydroxylating dioxygenase large terminal subunit (Paraburkholderia graminis OAS925)
MTSPATSQPAADPIQSYLDRGLRNYWYPVAPSWQVGDAPIGITRLGDQIVLWRDKEGKVH
ALEDRCPHRGARLSLGWNLGGSVACWYHGIEINGGGTVTKVPAVSNCPLEGQKCVKSYPA
EEHAGAIFLWFGDDAHKEPAPLKLPEELVGDEYASFLCMSNWKCNYQYAIDNVMDPMHGA
YLHATSHSMAEGDKQADMRVRKTETGLMFEKVGQRDVNFDWVELGETGCLWMRLAIPYKK
KFGPGGNFGIIGFAVPVDENNCQVYFWRTRKVQGWQRDAWRFMYRNRLEGLHWAVLEQDR
YVLESMAPNAREHEFLYQHDVGMTRVRRMLRQRAQQDFAALEAHQAQAAQTEAAGQNHA