Protein Info for ABIE53_004479 in Paraburkholderia graminis OAS925

Annotation: serine/threonine protein kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 727 transmembrane" amino acids 404 to 425 (22 residues), see Phobius details PF00069: Pkinase" amino acids 129 to 350 (222 residues), 139.3 bits, see alignment E=4.2e-44 PF07714: PK_Tyr_Ser-Thr" amino acids 129 to 369 (241 residues), 90.1 bits, see alignment E=3.9e-29 PF03109: ABC1" amino acids 207 to 285 (79 residues), 30.6 bits, see alignment E=5e-11

Best Hits

KEGG orthology group: None (inferred from 89% identity to bug:BC1001_4597)

Predicted SEED Role

"serine/threonine protein kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (727 amino acids)

>ABIE53_004479 serine/threonine protein kinase (Paraburkholderia graminis OAS925)
MASLARVIHDFQNGELSRDEFVAQLDSTLVTEGLGPTQLLETLGAAHRKAPLPEDLYIEV
RRRIEQLRVSNVAAGGEETGIQTTVEMPSVVPAGAGRTGASASSANVPNGAGFDQIKGIG
DTLNNRFVLEECLGVGGMGTVYKALDLRKLEASDRKPYLAVKVLNVQFRGNPNSLVALQR
EARKAQVLAHRNIITVYDFDRDGPIVYLTMEYLSGKPLSQLLRTPGYQGMPVRAALPIVR
GMCSALAYAHERGFVHCDFKPANVFLTTNAEVKVIDFGIARVFQRPEEESDATVFDPGSL
GALTPAYASPEMIEHREPDPRDDIYALGCITYELLTGHHPFDRLSATQARNAEFKLQRPP
NLDATQWRALRAALSFDRATRMPSVARFIAEFDNEARAEKSGTLAKAGLAGFAVICAAAV
AVYAWRSAPNRHSETQLAASASQGRVEEAASSAMQASEAAATAATSTASAATTNPTAATS
ASATASAAVAAPTPPAAPKPKPALTLAAVAPTLAQVPCSALSASTQDHTLTVRGYLSQRY
GVARLKDGLTALPGVDTLKLDVEPVADDKCDTVKALAPYWTQNWQAGHIAGLQVRPPSGQ
LNEGDPLVVDVSTPGYDSYVNLDYYQLDGNVVHMVPSPRAKDNQAPPHYSATVGSAGDWV
ISKPFGSEMVVLLITPAPLFDKPRPEAESRADYLRALDTRLAQIATKYGRERIVADFAPI
TTKPHAP