Protein Info for ABIE53_004416 in Paraburkholderia graminis OAS925

Annotation: zinc transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 transmembrane" amino acids 282 to 304 (23 residues), see Phobius details amino acids 317 to 337 (21 residues), see Phobius details PF01544: CorA" amino acids 52 to 335 (284 residues), 174.7 bits, see alignment E=1.4e-55

Best Hits

KEGG orthology group: K03284, metal ion transporter, MIT family (inferred from 95% identity to bgf:BC1003_4946)

Predicted SEED Role

"Mg2+ and Co2+ transporters"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (343 amino acids)

>ABIE53_004416 zinc transporter (Paraburkholderia graminis OAS925)
MKSELLLQTYGSDSSGIVCGFVFSPTQAGRPISADEALEWLRAQQNSASHADEFLWLHFN
LAHSAAERWMHAQLDLPETFFDALREGSHSTRIEQADGALRAVVNDVMFNLEFTPSEIAT
LWIYAHQRIIVTARLKPLRSVDRLRASVKEGEIFRSPVELLVHLMRDQADLLVQIVRRTS
ADIDRIEDRFLSQRPTQNRLDLGAMRRMLTRLQRMLAPEPGAIFRLLARPPRWLHPEDVQ
DLRESTEEFSVVLSDMAGLIERVRLLQEEIISRLEEQNNRTLFTLTLVTVLAMPINIVAG
FFGMNVGGIPFAENHHGFWVLVVLVACFTGLAAWWAFRRRKER