Protein Info for ABIE53_004409 in Paraburkholderia graminis OAS925

Annotation: diguanylate cyclase (GGDEF)-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 499 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 272 to 282 (11 residues), see Phobius details amino acids 294 to 316 (23 residues), see Phobius details PF02743: dCache_1" amino acids 47 to 242 (196 residues), 63.6 bits, see alignment E=2e-21 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 329 to 495 (167 residues), 186.6 bits, see alignment E=1.5e-59 PF00990: GGDEF" amino acids 334 to 493 (160 residues), 181.1 bits, see alignment E=1.4e-57

Best Hits

KEGG orthology group: None (inferred from 72% identity to bcj:BCAL2852)

Predicted SEED Role

"FOG: GGDEF domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (499 amino acids)

>ABIE53_004409 diguanylate cyclase (GGDEF)-like protein (Paraburkholderia graminis OAS925)
MLSLRNNKNIAAWHLGPRAVFYGGFFIAIVMVSLCAASLYQSRQDALDRARETSRNVALI
AERDIERNFELYGLSLQSVVDGLGNRDVMALPPRLRNQILFDGATAAKNLGSMLVFDASG
KIIIDAGNDAPRTGNFADRDYFVVQRDNPNAGLYVSAPFHSRLRNGAPSIALSRRISNPD
GSFAGIALMAINLQYFHDLFGGLSLGQHGAISLIARNGLMIMRHPYDPKVIGRDISKAST
FRQFMTAEEGSFSDTSSIDGVRRLYYFRNFPHLPLIIMVAEAEPDIYAAWHRRALTIGSL
MSAFAVGFVALSFVLGTQLQRRLRAESELQLLARTDSLTGLHNRRTLGEILEQEWRRARR
THSVFSLLFVDIDRFKAYNDTYGHQAGDDALAAVARCIGDNIRRPADTAARYGGEEFIVV
LPDTPPQGASVIAEKIRSAINELAIEHAGSEYGRVTASIGSASWSPDHDADVTTVIKAAD
EALYNAKATGRNRVASCSE