Protein Info for ABIE53_004387 in Paraburkholderia graminis OAS925

Annotation: alcohol dehydrogenase (cytochrome c)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 575 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details TIGR03075: PQQ-dependent dehydrogenase, methanol/ethanol family" amino acids 37 to 545 (509 residues), 550.8 bits, see alignment E=1.6e-169 PF13360: PQQ_2" amino acids 79 to 232 (154 residues), 67.4 bits, see alignment E=2.4e-22 amino acids 458 to 527 (70 residues), 42.2 bits, see alignment E=1.2e-14 PF13570: PQQ_3" amino acids 79 to 121 (43 residues), 23.4 bits, see alignment 9.6e-09 amino acids 122 to 172 (51 residues), 18.4 bits, see alignment 3.8e-07 amino acids 468 to 508 (41 residues), 25.8 bits, see alignment 1.7e-09 PF01011: PQQ" amino acids 106 to 131 (26 residues), 22.7 bits, see alignment (E = 9.5e-09) amino acids 492 to 515 (24 residues), 27.2 bits, see alignment (E = 3.6e-10)

Best Hits

KEGG orthology group: None (inferred from 96% identity to bug:BC1001_4980)

Predicted SEED Role

"Quino(hemo)protein alcohol dehydrogenase, PQQ-dependent (EC 1.1.99.8)" (EC 1.1.99.8)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.99.8

Use Curated BLAST to search for 1.1.99.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (575 amino acids)

>ABIE53_004387 alcohol dehydrogenase (cytochrome c) (Paraburkholderia graminis OAS925)
MKARSIRTMRRGALAISVAAAVGLSCATAAVADDYPAVTYERLTAAQSDPGWLTYYRTYN
GQAHSPLKQIDTSNVKQLKQVWSYKFPAELQQGFEATPIVNGRYLFVTTPKDNVYAFDAA
SGKQLWKFEPKLSAESFKTACCDVINRGVALYGKNVYVAMLNGEVVALDAQTGSPTWRKA
MFEPGVGYAFSLAPLALDGALVVGSAGGEYGARGFIAALNPDNGNVLWKRFTVPAAGEKG
GNTWPDGMQEHGGAPAWLTGTYDAASKTLYWGVGNPGPWLADLRPGDNLYSDSLLALDPK
TGDLKWHYQYTKHDTWDYDGVNTPVLANIKYQDKDYDAIIHADRNGYFHAIDRSTGKLIY
AKPFVKATSVTGYTADGAPIQDPAKYPKTGTTIETCPSFLGGKNWWSVSYDPDKHIAIVP
ALHACMSLSGKSVTYMEGLPYLGEGFEIKPEPGSKGYGELQAIDVGTGKKLWSFWSKLPW
NGGVATTAGGLAFSGSLDGHLYAFDTATGKVLWKSPKLASGIVAQPSVFEVDGKEYVAIL
AGYGGANPIWGGPMAKAAEKVPRGGTLYVFALNRG