Protein Info for ABIE53_004383 in Paraburkholderia graminis OAS925

Annotation: transcriptional regulator of acetoin/glycerol metabolism

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 657 PF01590: GAF" amino acids 68 to 197 (130 residues), 46.5 bits, see alignment E=1.4e-15 PF00158: Sigma54_activat" amino acids 340 to 502 (163 residues), 229.6 bits, see alignment E=4.5e-72 PF14532: Sigma54_activ_2" amino acids 343 to 508 (166 residues), 73.3 bits, see alignment E=6.2e-24 PF02954: HTH_8" amino acids 614 to 645 (32 residues), 46 bits, see alignment (E = 8.7e-16)

Best Hits

KEGG orthology group: None (inferred from 93% identity to bug:BC1001_4984)

Predicted SEED Role

"Transcriptional activator of acetoin dehydrogenase operon AcoR" in subsystem Acetoin, butanediol metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (657 amino acids)

>ABIE53_004383 transcriptional regulator of acetoin/glycerol metabolism (Paraburkholderia graminis OAS925)
MRDDMYHAATPIATREACWLTPSIQKSHERSEVFGLSESMRPDYDVLPAGELAMKLEQNR
ILCAHATPVMETLHEQIVNTQSMIVLTDAEGLILHSIGDDDFLRRAEKVALRPGANWAES
RQGTNAIGTALAERSATVVHGEQHYLAANRFLTCSSVPILDPYGDLIGVLDVTGDHRSYH
QHTMALAKMSVQMIENHLFANTFRETLQIAFHGRPEFLGTLMEGIAAFTCDGRFLSANRS
AQFQLGLPLAGLRAHTLSSLFGLTSAQLIDRLRMHRDRHLSLNLSNGAVVCANVQFRRTT
LADEPARFHTSNEAAAGKRNEPCAPPANPLSTLSQLDTGDPRIAAVITKVRKVIGKNIPI
LITGETGTGKELLAQAIHNDSPRRAAPFVAVNCASIPETLIESELFGYEEGAFTGARRKG
AVGKLLQANGGTLFLDEIGDMPYPLQVRLLRVLQERLVNPLGSAKSIPVDVAIICATHRD
LREMIAQSRFREDLYYRLNGLVVKLPPLRERTDLSAVIKKMLDCASAENAGDQPLSIAGD
VMTLFEQCAWPGNFRQLGNLLRTAAVMVDADGEIRREHLPDDFFDDLRAARPSSTHAADA
LPLPSGRLHDVAASVIANALAQHGGNVSAAARTLGISRNTIYRKLPAHGANNSEDAA