Protein Info for ABIE53_004333 in Paraburkholderia graminis OAS925

Annotation: iron(II)-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 TIGR03440: ergothioneine biosynthesis protein EgtB" amino acids 11 to 439 (429 residues), 259.3 bits, see alignment E=4.1e-81 PF12867: DinB_2" amino acids 15 to 147 (133 residues), 36.9 bits, see alignment E=4.9e-13 PF03781: FGE-sulfatase" amino acids 181 to 335 (155 residues), 75.5 bits, see alignment E=5.5e-25 amino acids 341 to 440 (100 residues), 62 bits, see alignment E=7.1e-21

Best Hits

KEGG orthology group: None (inferred from 85% identity to bpy:Bphyt_4271)

Predicted SEED Role

"Serine/threonine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (442 amino acids)

>ABIE53_004333 iron(II)-dependent oxidoreductase (Paraburkholderia graminis OAS925)
MNRDPRPHHPLVQRLIDARQVTDALFSIVKPEFLYERPIRERHRIVFYIGHLEAFDRNLF
DQRLFELPAFDPQLDQLFAFGIDPVDGGFPTDQPGDWPSLQTVREYGLRAREQIDRELRA
LTDSARVDASEQLLNVAIEHRLMHAETLAYMLHQLPLAQKVTELREPVVTGPGRANGASP
MVRVPAGSATLGMRRDGGRFGWDNEFGELQVDVPAFEIDRYMVTNGAFREFIDAGGYREP
KWWSEQDWAWKEAEGIEHPACWSRRSVNSERNGEDSGEGNGVRDEWTLRTMFDDVPLPLD
WPAYVSHAEASAYARWAGKALPTEAQWQRAAQGAPHAGSGNFDFRSWDPRPVDAYPENVS
AFGVEGQFGNGWEWTSTLFDGLPGFEPFPFYLGYSANFFDGKHYVLKGGSARTAQCMLRP
TFRNWFQPHYQYVYAGFRCVSA