Protein Info for ABIE53_004300 in Paraburkholderia graminis OAS925

Annotation: polar amino acid transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 57 to 77 (21 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 187 to 209 (23 residues), see Phobius details TIGR03003: ectoine/hydroxyectoine ABC transporter, permease protein EhuD" amino acids 5 to 214 (210 residues), 315.3 bits, see alignment E=2.3e-98 TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 14 to 111 (98 residues), 91.1 bits, see alignment E=5.2e-30 PF00528: BPD_transp_1" amino acids 36 to 213 (178 residues), 83.6 bits, see alignment E=7.6e-28

Best Hits

Swiss-Prot: 47% identical to Y4TG_SINFN: Probable amino-acid ABC transporter permease protein y4tG (NGR_a01520) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 99% identity to bug:BC1001_4317)

MetaCyc: 34% identical to cystine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-290 [EC: 7.4.2.12]; 7.4.2.12 [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (219 amino acids)

>ABIE53_004300 polar amino acid transport system permease protein (Paraburkholderia graminis OAS925)
MNSFFDLHYAEQILPALLRASMYTIFITLIGFAIALVLGLVLAVLRRSPVKAVSRTVGFI
VEFIRSTPLLIQVYVLFYVLPVYGITMSALTAGTVGIALHYACYTSEVYRAGLNGVARGQ
WEAACALSLSPWRTYSGVILPQAIRPVIPALGNYLVAMFKDTPVLSAITVVELMQQAKNI
GSETFRYLEPITLAGIFFLLISITFAQLVRRLEYGLRLP