Protein Info for ABIE53_004281 in Paraburkholderia graminis OAS925

Annotation: GTP cyclohydrolase I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 PF01227: GTP_cyclohydroI" amino acids 28 to 205 (178 residues), 247 bits, see alignment E=4.2e-78 TIGR00063: GTP cyclohydrolase I" amino acids 29 to 205 (177 residues), 210.8 bits, see alignment E=5.7e-67

Best Hits

Swiss-Prot: 63% identical to GCH1_XANC5: GTP cyclohydrolase 1 (folE) from Xanthomonas campestris pv. vesicatoria (strain 85-10)

KEGG orthology group: K01495, GTP cyclohydrolase I [EC: 3.5.4.16] (inferred from 91% identity to bxe:Bxe_B0641)

MetaCyc: 48% identical to GTP cyclohydrolase I (Bacillus subtilis subtilis 168)
GTP cyclohydrolase I. [EC: 3.5.4.16]

Predicted SEED Role

"GTP cyclohydrolase I (EC 3.5.4.16) type 1" in subsystem Folate Biosynthesis or Molybdenum cofactor biosynthesis or Pterin biosynthesis or Queuosine-Archaeosine Biosynthesis (EC 3.5.4.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.16

Use Curated BLAST to search for 3.5.4.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (216 amino acids)

>ABIE53_004281 GTP cyclohydrolase I (Paraburkholderia graminis OAS925)
MTSSKTEQTTATTTTEAANGRPSREEAEAAVRVLLRWAGDNPEREGLIDTPARVVRSYEE
FYAGYQIDPREILARTFSEVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPGHRVV
GISKLARLVDAFAKRLQIQEKMTVQIADTLNDVLQPEGVGVILEASHQCMSTRGVHKAGV
TMVTSRMLGTFRTDPSTRREFLSIVGNPGAVAVHNT