Protein Info for ABIE53_004234 in Paraburkholderia graminis OAS925

Annotation: protein-L-isoaspartate(D-aspartate) O-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 TIGR00080: protein-L-isoaspartate O-methyltransferase" amino acids 5 to 211 (207 residues), 197.9 bits, see alignment E=9.5e-63 PF01135: PCMT" amino acids 10 to 211 (202 residues), 191.9 bits, see alignment E=2.4e-60 PF13847: Methyltransf_31" amino acids 77 to 151 (75 residues), 38.6 bits, see alignment E=1.9e-13 PF05175: MTS" amino acids 77 to 149 (73 residues), 23.4 bits, see alignment E=7.9e-09 PF13649: Methyltransf_25" amino acids 82 to 158 (77 residues), 31.8 bits, see alignment E=3.9e-11

Best Hits

Swiss-Prot: 55% identical to PIMT1_RHOP2: Protein-L-isoaspartate O-methyltransferase 1 (pcm1) from Rhodopseudomonas palustris (strain HaA2)

KEGG orthology group: K00573, protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC: 2.1.1.77] (inferred from 73% identity to bxe:Bxe_C1354)

Predicted SEED Role

"Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77)" in subsystem Ton and Tol transport systems (EC 2.1.1.77)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.77

Use Curated BLAST to search for 2.1.1.77

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (235 amino acids)

>ABIE53_004234 protein-L-isoaspartate(D-aspartate) O-methyltransferase (Paraburkholderia graminis OAS925)
MSDFNEARERMVERQLVRRGICDSRVLDAMRRVPREAFVPDCLRDLAYEDRPLPIGNDQT
ISQPAIVATMIEAAELSSADIVLDIGTGSGYAAAVAAALSAHVHSIERHADLVAMARDIL
ARLNISNVTVYLGDGTAGLAEHAPYDAIIAAAGGPHIPRIWRKQLAIGGRIVMPVGRERH
YQKLVKLVRRSEDDYESCSLGEVSFVPLVGADAWPAPDAAQSDGAAPQRIQETSP