Protein Info for ABIE53_004192 in Paraburkholderia graminis OAS925

Annotation: PAS domain S-box-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 543 PF00072: Response_reg" amino acids 14 to 125 (112 residues), 93.1 bits, see alignment E=3.8e-30 TIGR00229: PAS domain S-box protein" amino acids 200 to 321 (122 residues), 52.2 bits, see alignment E=3.2e-18 PF13188: PAS_8" amino acids 204 to 261 (58 residues), 28.3 bits, see alignment 3.7e-10 PF00989: PAS" amino acids 204 to 311 (108 residues), 39.1 bits, see alignment E=2e-13 PF13426: PAS_9" amino acids 214 to 313 (100 residues), 38.4 bits, see alignment E=3.9e-13 PF07730: HisKA_3" amino acids 342 to 408 (67 residues), 56.8 bits, see alignment E=8.4e-19 PF02518: HATPase_c" amino acids 448 to 538 (91 residues), 44 bits, see alignment E=8e-15

Best Hits

KEGG orthology group: None (inferred from 94% identity to bug:BC1001_4222)

Predicted SEED Role

"COG0745: Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (543 amino acids)

>ABIE53_004192 PAS domain S-box-containing protein (Paraburkholderia graminis OAS925)
MSEMTLPGDASPTVLIADDNPANLAVVVESLVARGFKVLVALDGPEAIQRAQFSQPDLIL
LDVRMPGIDGFETCRRLKSDERTRNIAVIFMTSLTGSDDMVEGFSAGGVDYLTKPVHVDE
MMARISTHLALRGMHQKLIAQNRQLQEEVFVRQRAESALSRVRDGLEESVAQRTDELARA
NATLQAQIEERRRAEARLVASEFRFRTIVETSPVPLCITSMPEGRILYTNKPLRELFGVD
YVTTHITNIGELYADTDDRDRLVDQLRHEGNFRNTEVKFRRPDGTMFWAIATARVATYDD
APAIFVGLNDITERKRIEQELVESREQLRELSAYMEAIREEERKRIAMEIHDELGQLLTA
LKMDVSLLKMRLPGDQEVARRADDMRELVERTIWMVRNVASHLRPAALNYGIVSALEWLV
DDFGRRSGLACQFRLNGNEPILSDAHATAMFRIVQASLTNVARHASATRADVTLTSTQAA
LDLHVSDDGCGFDQEAVRRDYSYGLLGMSERARLIGGSLLIDSAPGTGTSVSIHIPLQDG
LQT