Protein Info for ABIE53_004114 in Paraburkholderia graminis OAS925

Annotation: pimeloyl-ACP methyl ester carboxylesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 transmembrane" amino acids 72 to 89 (18 residues), see Phobius details PF12697: Abhydrolase_6" amino acids 6 to 242 (237 residues), 44.7 bits, see alignment E=5.2e-15 PF00561: Abhydrolase_1" amino acids 9 to 223 (215 residues), 48.7 bits, see alignment E=1.6e-16 PF12146: Hydrolase_4" amino acids 54 to 224 (171 residues), 45 bits, see alignment E=1.7e-15

Best Hits

KEGG orthology group: None (inferred from 76% identity to bgf:BC1003_5268)

Predicted SEED Role

"FIG084569: hydrolase, alpha/beta fold family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (259 amino acids)

>ABIE53_004114 pimeloyl-ACP methyl ester carboxylesterase (Paraburkholderia graminis OAS925)
MSTWILLRGLTRETRHWGRLPDVLREATGGAARLLLLDLPGNGEFAHLRAPATVAAMVEF
VRAAARQRGAAGPFNILAMSLGGMVATAWAQRHSDDIERLVLINTSMRPFSRAHQRLRPS
AWPGLVTVAMHWHDATRAETVIHRLTCNNADTLQADLESWATIRRSAPVSRGNGWRQLWA
AARFTAGTAKPACPLLLLSSRDDRLVDPACSARLAAAWGAPHREHAWAGHDLPHDDPAWV
AEQIRAWLAHETVESTATR