Protein Info for ABIE53_004084 in Paraburkholderia graminis OAS925

Annotation: glycine/D-amino acid oxidase-like deaminating enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01266: DAO
  • amino acids 10 to 355 (346 residues), 203.3 bits, E=8.2e-64
• PF13450: NAD_binding_8
  • amino acids 13 to 46 (34 residues), 24 bits, 4e-09

Best Hits

KEGG orthology group: None (inferred from 94% identity to bug:BC1001_4118)

Predicted SEED Role

"D-amino-acid oxidase (EC 1.4.3.3)" in subsystem Proline, 4-hydroxyproline uptake and utilization (EC 1.4.3.3)

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis II (10/11 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (6/7 steps found)
• butanol and isobutanol biosynthesis (engineered) (3/8 steps found)
• L-lysine degradation V (3/9 steps found)
• superpathway of L-lysine degradation (12/43 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• D-Arginine and D-ornithine metabolism
• Glycine, serine and threonine metabolism
• Penicillin and cephalosporin biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.3

Protein Sequence (381 amino acids)

>ABIE53_004084 glycine/D-amino acid oxidase-like deaminating enzyme (Paraburkholderia graminis OAS925)
MGHPHGMTADALIVGAGIVGAACAAGLAALGMRVEVLDAQGIGGGATAAGMGHIVVMNDS
PAELALSLYSRDLWLQLAPRLRTRDAFARCGTLWLAADEEEWQAARAMHAAYEAHGVTAQ
LLDASALRQCEPAVAASLVGGLRIEHDSIVYAPTAAEWLLTQSPASANIGVRLGASVVSV
DATGVTLANGERRGARHVIVANGLGARELVPTLPLQPKKGHLLITDRYPELIHHQLLELG
YIKSAHHATGTSVAFNAQPRPTGQLLIGSSRQFDTTDPAVEMPVLAQMLQRAAHYLPMLP
QLNGIRAWTGFRAASPDGLPLIGPAGDAVPGVWLAVGHEGLGVTTSLATAKLLAAQIVGE
TAAIPVEPYLPARFVREVAHE