Protein Info for ABIE53_004076 in Paraburkholderia graminis OAS925

Annotation: 3-dehydroquinate dehydratase-2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 transmembrane" amino acids 120 to 135 (16 residues), see Phobius details PF01220: DHquinase_II" amino acids 6 to 141 (136 residues), 206.3 bits, see alignment E=7.2e-66 TIGR01088: 3-dehydroquinate dehydratase, type II" amino acids 6 to 144 (139 residues), 200 bits, see alignment E=6.2e-64

Best Hits

Swiss-Prot: 65% identical to AROQ2_BRADU: 3-dehydroquinate dehydratase 2 (aroQ2) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K03786, 3-dehydroquinate dehydratase II [EC: 4.2.1.10] (inferred from 96% identity to bpy:Bphyt_4568)

MetaCyc: 58% identical to periplasmic dehydroquinate dehydratase (Gluconobacter oxydans)
3-dehydroquinate dehydratase. [EC: 4.2.1.10]

Predicted SEED Role

"3-dehydroquinate dehydratase II (EC 4.2.1.10)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) or Quinate degradation (EC 4.2.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.10

Use Curated BLAST to search for 4.2.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (151 amino acids)

>ABIE53_004076 3-dehydroquinate dehydratase-2 (Paraburkholderia graminis OAS925)
MSFASVLVLNGPNLNLLGTREPAIYGSETLDDVARLCRDAGERLDLSIDFCQSNAEHQLI
DWLHAARTKVDGIVINPAAYTHTSVAIADALTAIEKPVIEVHISNVHRREAFRHHSYVSA
VADAIIVGCGTQGYVLALERMVTILKNRAAK