Protein Info for ABIE53_004065 in Paraburkholderia graminis OAS925

Annotation: fructose transport system substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details PF00532: Peripla_BP_1" amino acids 36 to 253 (218 residues), 79.8 bits, see alignment E=2.4e-26 PF13407: Peripla_BP_4" amino acids 38 to 298 (261 residues), 177.4 bits, see alignment E=4.3e-56

Best Hits

Swiss-Prot: 56% identical to FRCB_RHIML: Fructose import binding protein FrcB (frcB) from Rhizobium meliloti

KEGG orthology group: K10552, fructose transport system substrate-binding protein (inferred from 97% identity to bpy:Bphyt_4581)

Predicted SEED Role

"Fructose ABC transporter, substrate-binding component FrcB" in subsystem Fructose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (334 amino acids)

>ABIE53_004065 fructose transport system substrate-binding protein (Paraburkholderia graminis OAS925)
MNLNSRRLPVARKIVSMCVAASAVWCASASQAADQPVVGLITKTDTNPFFVKMKQGAEAA
ASKDGAKLITAAGRFDGDNASQVTAIENMMTAGAKAILITPSDTKAIVPSIKKARAAGVM
VVALDTPTDPQDATDALFATDNFKAGVLIGKYAKAALNGKPAKIATLDLAPGVSVGVLRH
NGFLEGFGVKEGDASIVCSQDTRGDQAKGQTAMENCLQKAPDINVVYTINEPAAAGAYRA
LKAAGKDKSVMIVSIDGGCEGVRNVKAGSIAATSQQYPLKMASLGVTAGVDYAKTGKKVT
GYQDTGVTLITDKPMSGIDSKDTKFGVDNCWGNK