Protein Info for ABIE53_004060 in Paraburkholderia graminis OAS925

Annotation: multiple sugar transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 transmembrane" amino acids 48 to 69 (22 residues), see Phobius details amino acids 110 to 130 (21 residues), see Phobius details amino acids 142 to 163 (22 residues), see Phobius details amino acids 187 to 210 (24 residues), see Phobius details amino acids 233 to 257 (25 residues), see Phobius details amino acids 263 to 265 (3 residues), see Phobius details amino acids 292 to 312 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 122 to 313 (192 residues), 50.9 bits, see alignment E=8e-18

Best Hits

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 94% identity to bug:BC1001_4094)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, permease protein UgpA (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (322 amino acids)

>ABIE53_004060 multiple sugar transport system permease protein (Paraburkholderia graminis OAS925)
MSHSVTRHTVDGSVQPGGSALPASRDRAPNVRTRGRRPSPTARRQRRAAFLFLAPACVMV
AIYVIWPILSTIRLSFFNWDGMTEPTFVGLANYVELFNAQTFYTALKNNVIWLLLFLLAP
PMGLAVALYLNQAVAGIRIVKSLFFAPFVLSGVVVGLIFSWFYDPTFGLLALILGHGVPV
LGDPRYATFGIVFAALWPQTAYCMILYLTGLTSLNAEQIEAARMEGARGWSMLWHVILPQ
LRPTTFMAIVVTIIGALRSFDLISVMTGGGPFESSTVLAYYMYDQAIKYYRIGYSAAVAV
VLFGIMLVYIVYHLRRMLRTEQ